PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G131300.1
Common NamePOPTR_0003s13120g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TALE
Protein Properties Length: 665aa    MW: 74280.6 Da    PI: 6.7733
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G131300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.4e-094284651954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Potri.003G131300.1 428 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 465
                         554458******************************88 PP

2BELL114.84.4e-37290360272
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         + elqk+k+k+ls+leeVd+rY++y++q++t++ssFeavag g+a +Y +lA+ka+SrhFrcL+d i+ qi
  Potri.003G131300.1 290 FIELQKRKTKMLSMLEEVDRRYRHYCDQMKTMVSSFEAVAGTGAASVYSALASKAMSRHFRCLRDGIVAQI 360
                         689******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.3E-56228358IPR006563POX domain
PfamPF075262.8E-45234356IPR006563POX domain
PROSITE profilePS5007112.034406469IPR001356Homeobox domain
CDDcd000862.26E-11409470No hitNo description
SMARTSM003891.1E-8409473IPR001356Homeobox domain
SuperFamilySSF466891.07E-16410475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-27412475IPR009057Homeodomain-like
PfamPF059208.9E-18426465IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MAREPCEDKS RNMVSSGSFC YPDVSSSNPT IQTHLVNQIQ GYESNPEIFN LTTGMEMIGF  60
SKNLQHQQSD SNSVMWKGFF NKPANNHHPG GPSSSKTIHE STSGDFYQHE FSKPDFSTGI  120
SEASNENLMV GADHSAPWQE NRLLVDDSSL TCVFPCEGNE RPSQGLSLSL CPSNPSSIGL  180
HSFELRHTPT HQNQDNSQEE MRFFGKSPAN IQQQMMQDGF LKAANLHHQA QFQLRNSKYL  240
GPAQDLLNEF CNIRTKQGDA LKQKPHKPKQ LDDDQNGSSS RKQSLESLEF IELQKRKTKM  300
LSMLEEVDRR YRHYCDQMKT MVSSFEAVAG TGAASVYSAL ASKAMSRHFR CLRDGIVAQI  360
HATKKAMGEK DPVAPGTTKG ETPRLKILDQ ALRQQRAFQQ MSMMESHPWR PQRGLPERSV  420
SFLRAWLFEH FLHPYPSDVD KHILARQTGL SRSQVSNWFI NARVRLWKPM VEEMYLEETK  480
EQDKNMASSD GVTDLDENIN GRPNQNPSST DQKPTPDHLI RIDSECLSSI ISNPDKNGTN  540
KSTISFQSHH LQHQQQSFGN FGSMDLDFSS YNHHAAGGVS YANDSASNQN FNGGGGVSLT  600
LGLQQHGGSG VSLAFSPASQ SSLFYPRDHI EDCQPVQYSL LDGEGQNLPY RNLMGAQLLH  660
DMAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15415473563Homeobox protein Meis2
3k2a_B4e-15415473563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0292921e-142CT029292.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385769.10.0hypothetical protein POPTR_0003s13120g
RefseqXP_006385771.10.0hypothetical protein POPTR_0003s13120g
RefseqXP_006385773.10.0hypothetical protein POPTR_0003s13120g
SwissprotQ388971e-148BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLU5GJA20.0U5GJA2_POPTR; Uncharacterized protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-145TALE family protein